PMN BLAST 2.2.8

General Information

BLAST stands for Basic Local Alignment Search Tool and was developed by Altschul et al. (1990) and significantly improved by Altschul et al. (1997). It is a very fast search algorithm that is used to separately search protein or DNA databases. BLAST is best used for sequence similarity searching, rather than for motif searching. For searches using a query sequence of fewer than twenty residues, other programs, such as PatMatch for Arabidopsis thaliana proteins at TAIR. To search additional datasets, you may try NCBI BLAST.
A fairly complete on-line guide to BLAST searching can be found at the NCBI BLAST Help Manual. For a theoretical overview of BLAST, see the NCBI BLAST Course. Additional information can be found in the BLAST 2.0 Release Notes

Browser Incompatibilities

Note: This site has been tested with IE8.X, Safari 3.X and Firefox/Mozilla 5.X browsers. Some pages may not work as expected if you are using older browsers.

BLAST Methods

The NCBI BLAST family of programs hosted the PMN includes:

blastp:
compares an amino acid query sequence against a protein sequence database.
blastx
compares a nucleotide query sequence translated in all reading frames against a protein sequence database.

PMN BLAST Datasets

The following datasets are available for PMN-BLAST-2.2.8

Dataset Type Description Source
Reference Enzymes Protein Enzymes with experimentally supported* activity and protein sequence information. Includes enzymes from all kingdoms and some enzymes not directly involved in metabolism. UniProt (2009), MetaCyc (12.5), BRENDA (2009), TAIR8
PlantCyc Enzymes Protein Enzymes found in PlantCyc with known protein sequences. Both experimentally and computationally supported enzymes are included. PlantCyc 2.0 (March 2009)

Entering query sequences

When pasting sequences into the text box, be aware that a single sequence is limited to 7000 characters in length; when you paste multiple sequences (up to five are allowed) you are limited to a total of 15,000 characters. These limitations may be changed in the future. If you have a longer sequence, or many sequences, use the file upload feature. This feature is not supported on some versions of Microsoft's Internet Explorer web browser. If you do not see a "Browse..." button near the file upload text box (that displays your computer's filesystem directory when clicked), we suggest using Netscape or another browser supporting file uploading.

Multiple query sequences

To submit multiple query sequences, paste up to 5 sequences into the input box or,upload a file containing the concatenated sequences in FASTA format. For this option the files cannot be in raw format because they will be interpereted as a single query sequence. For NCBI-BLAST it may be possible to upload more than five sequences depending on the length of the query sequence and size of the target database.See the following section on Input file size limits. WuBLAST has a defined limit of 5 sequences.

Using the Browse option to upload a local file

NOTE:If you are uploading a file, make sure the file is in text format. If your file is a WORD document, open the file in Word and save again as text only format.
  • Macintosh
    1. Click on Browse button
    2. Click on folders to open them, and on the file to upload it
  • PC
    1. Click on the Browse button
    2. Change the file type from "HTML" to "all files"
    3. Click on folders to open them, and on the file to upload it
  • UNIX
    1. Click on the Browse button
    2. Change *.html to * at the end of the string in the Filter box
    3. Click on a folder and then the Filter button to open the folder
    4. Click on a file and then the OK button to upload it
Word documents will not work unless saved as text first.

Input file size limits

For NCBI BLAST limits are imposed on the size of the input files based upon the type of query being performed and the size of the dataset being searched. For example, the limit for TBLASTX against a large data set such as GenBank AGI sequences is 1000 characters, whereas for a small dataset like TIGR CDS sequences the limit is 3000 characters. The following table lists the search type and limits for NCBI Blast. If your files are larger, try using WU-BLAST2 instead.

Search Type Large data set input character limit Small data set input character limit
BLASTN 25000 25000
BLASTX 25000 25000
BLASTP 5000 5000
TBLASTN 1000 3000
TBLASTX 1000 3000

Input Data Formats

  • Raw text format

    An example sequence in raw format is:

    GGAAAAATCGAAGGATAATCTGTTTCTTCCAGCACAAGTTAACTTGCAAGAGAGAGCT
    CAAAGATGGAACCAACAGAAAAACCATCGACCAAACCATCTTCTCGGACTCTACCTAG
    AGACACTCGTGGCTCTCTCGAAGTATTCAACCCGTCAACTCAGCTGACCCGACCCGAT
    AACCCGGTGTTCCGTCCTGAACCACCAGCGTGGCAAAACTTGAGTGATCCACGTGGCA
    CCAGTCCTCAACCCCGACCACAACAAGAACCAGCTCCATCCAACCCTGTTCGGTCTGA
    TCAAGAAATCGCTGTCACGACCTCATGGATGGCTCTGAAAGACCCATCACCGGAGACA
    ATCTCCAAG
    
  • FASTA format

    A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column. It is recommended that all lines of text be shorter than 80 characters in length. An example sequence in FASTA format is:

    >gi|1122533|gb|AAB05099.1| BELL1
    MARDQFYGHNNHHHQEQQHQMINQIQGFDETNQNPTDHHHYNHQIFGSNSNMGMMIDFSKQQQIRMTSGS
    DHHHHHHQTSGGTDQNQLLEDSSSAMRLCNVNNDFPSEVNDERPPQRPSQGLSLSLSSSNPTSISLQSFE
    LRPQQQQQGYSGNKSTQHQNLQHTQMMMMMMNSHHQNNNNNNHQHHNHHQFQIGSSKYLSPAQELLSEFC
    SLGVKESDEEVMMMKHKKKQKGKQQEEWDTSHHSNNDQHDQSATTSSKKHVPPLHSLEFMELQKRKAKLL
    SMLEELKRRYGHYREQMRVAAAAFEAAVGLGGAEIYTALASRAMSRHFRCLKDGLVGQIQATSQALGERE
    EDNRAVSIAARGETPRLRLLDQALRQQKSYRQMTLVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSD
    VDKHILARQTGLSRSQVSNWFINARVRLWKPMIEEMYCEETRSEQMEITNPMMIDTKPDPDQLIRVEPES
    LSSIVTNPTSKSGHNSTHGTMSLGSTFDFSLYGNQAVTYAGEGGPRGDVSLTLGLQRNDGNGGVSLALSP
    VTAQGGQLFYGRDHIEEGPVQYSASMLDDDQVQNLPYRNLMGAQLLHDIV
    
  • GCG format

    An example sequence in GCG format is:

    !!NA_SEQUENCE 1.0
    nga361
    nga361.seq  Length: 204  February 22, 1999 12:09  Type: N  Check: 234  ..
    1  TTATATGATA TATATAGTTA TGTATGTTNC AAGAATNCGA TATGGNACGC
    51  ATGATTGAAG AATAATGATT GAGGAATTTT NCTGTAACAA AAAAATTNGA
    101  NATAAACAAN TNTGTGGCTA AGAACTTAAC AAGGNCACAT GTTGATATGT
    151  GAANTAGGAA TCTCATNATA AGGANCACAC GGTTGACAGC AAACGGGCNT
    201  NTAC
    
  • RSF format

    A Rich Sequence Format (RSF) file contains one or more sequences that may or may not be related. In addition to the sequence data, each sequence can be richly annotated with descriptive sequence information such as creator/author of the sequence, sequence weight, creation date, one-line description of the sequence, offset, or the number of leading gaps in a sequence that is part of an alignment or fragment assembly project, and known sequence features. An example sequence in RSF format is:

    !!RICH_SEQUENCE 1.0
    ..
    {
    name  Hs70_Plafa
    descrip    PileUp of: @Hsp70.List
    type    PROTEIN
    longname  Gendocdisk:[Gcgdoc.Program_Manual]Hsp70.Msf{Hs70_Plafa}
    checksum    1012
    creation-date 10/15/96  8:40:33
    strand  1
    sequence
    ~~~~~~~~~~~~~~~MASAKGSKPNLPESNIAIGIDLGTTYSCVGVWRNENVDIIANDQG
    NRTTPSYVAFT.DTERLIGDAAKNQVARNPENTVFDAKRLIGRKFTESSVQSDMKHWPFT
    VKSGVDEKPMIEVTYQGEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFND
    SQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLHKKG..KGEKNILIFDLGGGTFDVSLL
    TIED...G.IFEVKATAGDTHLGGEDFDNRLVNFCVEDFKRKNRGKDLSKNSRALRRLRT
    QCERAKRTLSSSTQATIEIDSLFEGID....YSVTVSRARFEELCIDYFRDTLIPVEKVL
    KDAMMDKKSVHEVVLVGGSTRIPKIQTLIKEFFNGKEACRSINPDEAVAYGAAVQAAILS
    G.DQSNAVQDLLLLDVCSLSLGLETAGGVMTKLIERNTTIPAKKSQIFTTYADNQPGVLI
    QVYEGERALTKDNNLLGKFHLDGIPPAPRKVPQIEVTFDIDANGILNVTAVEKSTGKQNH
    ITITNDKGRLSQDEIDRMVNDAEKYKAEDEENRKRIEARNSLENYCYGVKSSLEDQKIKE
    KLQPAEIETCMKTITTILEWLEKN.QLAGKDEYEAKQKEAESVCAPIMSKIYQDAAGAAG
    .GMPGGMP..GGMPGGMPSGMPGGMNFPGGMPGAGMPGNAPAGSGPTVEEVD~~~~~~
    }
    

Filtering

Filtering masks off segments of the query sequence that have low compositional complexity, as determined by the SEG program of Wootton & Federhen (Computers and Chemistry, 1993) or, for BLASTN, by the DUST program of Tatusov and Lipman (in preparation). Filtering can eliminate statistically significant but biologically uninteresting reports from the BLAST output (e.g., hits against common acidic-, basic- or proline-rich regions), leaving the more biologically interesting regions of the query sequence available for specific matching against database sequences.

Filtering is only applied to the query sequence (or its translation products), not to database sequences. Default filtering is DUST for BLASTN, SEG for other programs. It is not unusual for nothing at all to be masked by SEG, when applied to sequences in SWISS-PROT, so filtering should not be expected to always yield an effect. Furthermore, in some cases, sequences are masked in their entirety, indicating that the statistical significance of any matches reported against the unfiltered query sequence should be suspect.

Results Options

Output title

Type in the title you would like to appear at the top of your BLAST output.

E-mail address:

Entering your email address is suggested even if requesting a browser reply, and may be mandatory depending on server configuration options. Depending on server loading, or the expected execution time of your request, the server may convert your request to an email reply and auto-select the E-mail URL option. This avoids the frustration of wondering when your job will finish, and allows you to request more jobs quicker.

Return Results:

To your web browser

Your job will run immediately and return results directly to your Web browser in HTML format. Accession numbers that appear in the query and target loci names and descriptions will be hyperlinked to allow easy access to additional sequence information.

NOTE: Attempting to view large result files may cause your browser to "blank out". If you have trouble viewing results, particularly if you've asked for many scores and alignments, or submitted many queries in one job, your browser's "memory" and "disk" cache settings may need to be increased. See your browser's help and preference menus for details. To prevent loss of a large HTML result file, you might wish to request emailing a URL to it rather than a browser reply. This way you'll be able to experiment with your browser's cache settings and retrieve the output as many times as you wish without waiting for your request to be re-run.

By E-mail message

The results are sent within the body of a normal email message, to the email address you enter. Any comments you type will appear as the Subject of the email message. Generally, you should use this option only if your mail system can handle large messages, and you've asked for textual output. If requesting HTML format by email, either of the following choices may be better if your mail reader software is not HTML-aware.

By E-mail notice to URL

Many mail systems have trouble with large email messages, and may split or truncate them. Our blast server will retain your results and send you a short email containing a URL (Uniform Resource Locator; to use with your web browser or HTML-aware mail reader) indicating where to obtain your results. We will delete your results after the date and time indicated in the email message.

Result Formats:

HTML hypertext

(file type "htm")
HTML format is used by web browsers. Accession numbers that appear in the query and target loci names and descriptions will be hyperlinked to allow easy access to additional sequence information. Embedded Java "Applets" may be used to render graphical information (e.g., the ClustalW dendrogram), which will not appear unless your browser is set to permit these applets to run.

Normal text

(file type "txt")
The results are returned as conventional human-readable text.

Comma-delimited records

(file type "csv")
Information is returned as quoted, comma-separated fields and records, compatible with Excel, Word, Access and most database products. These products allow simple viewing and sorting on any data column. For each query sequence, each rank score produces a record. Alignment text is included in those records when available. For example, if you ask for the best 100 scores and best 25 alignments, the alignment text fields will be null strings for the last 75 records of each query. For BLAST scores that return more than one alignment, a separate record is generated for each.

Tab-delimited records

(file type "tab")
Similar to comma-delimited, but no quotes are used, and tabs replace comma characters as the field separator. More commonly used in UNIX environments. The meaning of the columns are following.
DNA:
RANK, STATUS, SCORES, E-VALUES, PROGRAM, Gap Penalties (Existence), Gap Penalty (Extension), empty, empty, MATRIX, TEMPFILENAME, QUERY LENGTH, Frame of Query that the score was found for (empty for protein), QUERY NAME, DATASET, Target length, Frame of Target that the score was found for (empty for protein), DESCRIPTION, empty, emtpy, empty, empty, empty, empty, empty, empty, empty, Identities, empty, Gaps, Percentage ratio of identical matches to the length of the alignment, Percentage ratio of identical matches to the length of the query, unknown, unknown, empty, empty, empty, Query Start, Query End, Target Start, Target End, QUERY NT, COMPARISON, TARGET NT
Protein:
RANK, STATUS, SCORE, E-VALUE, PROGRAM, Gap Penalties (Existence), Gap Penalty (Extension), EMPTY, EMTPY, MATRIX, TEMPFILENAME, QUERY LENGTH, empty, QUERY NAME, DATASET, Target length, empty, DESCRIPTION, empty, empty, empty, empty, empty, empty, empty, empty, empty, Identities, Positives, Gaps, Percentage ratio of identical matches to the length of the alignment, Percentage ratio of identical matches to the length of the query, unknown, unknown, Percentage ratio of identical matches to the length of the target, unknown, unknown, Query Start, Query End, Target Start, Target End, empty, QUERY NT, COMPARISON, TARGET NT

Advanced parameters

View Default Settings

Max Scores

Default Setting
Restricts the number of short descriptions of matching sequences reported to the number specified; default limit is 25 descriptions. See also Expectation.

Max Alignments

Default Setting
Restricts database sequences to the number specified for which high-scoring segment pairs (HSPs) are reported; the default limit is 15. If more database sequences than this happen to satisfy the statistical significance threshold for reporting (see Expectation), only the matches ascribed the greatest statistical significance are reported.

Expectation

Default Setting
The statistical significance threshold for reporting matches against database sequences; the default value is 10, such that 10 matches are expected to be found merely by chance, according to the stochastic model of Karlin and Altschul (1990). If the statistical significance ascribed to a match is greater than the EXPECTATION threshold, the match will not be reported. Lower EXPECT thresholds are more stringent, leading to fewer chance matches being reported. Fractional values are acceptable.

Query and Database Genetic Code

Default Setting
Genetic code to be used in BLASTX translation of the query.

Gapped Alignments

Whether to allow gapped alignments; either ON or OFF.

>Gap Opening Penalty

Default Setting
Cost to open a gap; a 0 in the field means to use the default. Supported values for BLASTP, BLASTX, TBLASTN, and TBLASTX are limited.

Gap Extension Penalty

Default Setting
Cost to extend a gap, a 0 in this field means to use the default. Supported values for BLASTP, BLASTX, TBLASTN, and TBLASTX are limited.

Nucleic Mismatch

Default Setting
Penalty for a mismatch in the BLASTâ„¢ portion of run.

Nucleic Match

Default Setting
Reward for a match in the BLASTâ„¢ portion of run.

Word Size

Default Setting
The size of the initial word that must be matched between the database and the query sequence.

Matrix

Default Setting
The amino acid substitution matrix to be used for protein comparisons. Both BLOSUM and PAM matrices are available at several different levels of evolutionary distance.

Extension Threshold

The threshold above which BLASTâ„¢ will extend a hit found. The hit is based on finding a word of a certain size (see Word Size)

Reporting Threshold

This keyword allows a score value to be specified as the threshold for displaying scores. Scores below this value are not shown.

File output options

Advanced options for Comma- and Tab-delimited formats

Header-Record if checked, the first record will contain the field names as shown in the table below.
Selected Fields if left blank, a default set of fields is returned. To customize, select from the following keywords; put a space between each.

KEYWORDS

ClustalW does not presently support tab- and comma-delimited formats.
The fieldlist can contain any of the following keywords in any order and repeated as desired:

SEARCHID

Place the name of the search file in the record.

RANK

Place the score rank number in the record.

SCORE

Place the score in the record.

PSCORE

Place the p-score in the record.

ALGORITHM

Specify the algorithm to be used in the search.

ITERATION

Iteration number for PSIBLAST searches.

OPENPENALTY

Place the Open Penalty in the record.

EXTENDPENALTY

Place the Extend Penalty in the record.

FRAMEPENALTY

Place the Frame Penalty in the record.

SCALEFACTOR

Indicates the scale factor used. Default is 1.

MATRIX

Place the name of the PAM matrix file in the record.

QUERYNUMBER

Place the number of the query in the record. This number represents which query sequence the record is when multiple query files or multiple sequences are used in the search

QUERYFILE

Place the name of the query file in the record

QUERYLENGTH

Place the length of the query file in the record.

QUERYFRAME

Place the frame of the query with which the score was calculated, in the record.

QUERYTEXT

Place the description from the query file in the record.

TARGETFILE

Place the name of the target in which the score was found, in the record.

TARGETLENGTH

Place the length of the target locus in which the score was found, in the record.

TARGETFRAME

Place the frame of the target locus in which the score was found, in the record.

TARGETLOCUS

Place the name of the target locus in which the score was found, in the record.

TARGETACCESSION

Place the accession number of the target locus in which the score was found, in the record.

TARGETDESCRIPTION

Place the description of the target locus in which the score was found, in the record.

PERCENTSCORE

Place the ratio of the score to the maximum possible score in the record.

MAXSCORE
MAXSCORED
MAXSCOREC
MAXSCORE1
MAXSCORE2
MAXSCORE3
MAXSCORE-1
MAXSCORE-2
MAXSCORE-3

Place the maximum possible score in the record. These fields may be empty if a search was not requested in the frame referenced in the field.

MATCHES

Place the total number of alignment character matches in the record. These are perfect matches.

SIMILARITIES

The number of identical and similar matches.

GAPS

Place the total number of alignment gaps in the record.

PERCENTALIGNMENT

Place the ratio of the total identical matches to the alignment length in the record.

PERCENTQUERY

Place the ratio of the total identical matches to the query length in the record.

PERCENTTARGET

Place the ratio of the total identical matches to the target locus length in the record.

SIMPERCENTALIGNMENT
SIMPERCENTQUERY
SIMPERCENTTARGET

These are the same as the percent fields above, except that the percentage is that of similar matches, not the identical matches.

QUERYSTART

Place the query start location in the record.

QUERYEND

Place the query end location in the record.

TARGETSTART

Place the target locus start location in the record.

TARGETEND

Place the target locus end location in the record.

QUERY

Place the query data for the alignment in the record.This field is for BLAST searches only. Use the following fields for Smith-Waterman related searches.

QUERYNT

Place the query nucleotide data for the alignment in the record.

QUERYAA

Place the query amino acid data for the alignment in the record.

COMPARISON

Place the alignment comparison information in the record.

TARGET

Place the target locus nucleotide data for the alignment in the record.This field is for BLAST searches only. Use the following fields for Smith-Waterman related searches.

TARGETNT

Place the target locus nucleotide data for the alignment in the record.

TARGETAA

Place the target locus amino acid data for the alignment in the record.

EXAMPLES

FIELDS: RANK SCORE QUERYNT COMPARISON TARGETNT

This example causes comma-delimited output to contain the specified fields. A sample output may look like the following:

"1", "10.0","ACGT","|| ", "ACAC"
"2", "5.0","ACGT","| ", "ATAC"


BLAST Options and Defaults

BLASTP BLASTX
Gap opening penalty:
cost to open a gap [integer]
default = 11
limited values are supported
default = 11
limited values are supported
Gap extension penalty:
cost to extend a gap [integer]
default = 1
a 0 in this field means to use the default
default = 1
a 0 in this field means to use the default
Nucleic match:
reward for a match in the BLAST portion of run [integer]
n/a n/a
Nucleic mismatch:
penalty for a mismatch in the blast portion of run [integer]
n/a n/a
Expectation value:
(E) [real]
default = 10.0 default = 10.0
Word size:
the size of the initial word that must be matched between the database and the query sequence
default = 3 default = 3
Max scores:
Number of one-line descriptions (V) [Integer]
default = 25 default = 25
Max alignments:
number of alignments to show (B) [integer]
default = 15 default = 15
Query filter:
filter applied to the query sequence
default = SEG default = SEG
Query genetic code:
genetic code to be used in BLASTX translation of the query
n/a default = universal
Matrix:
substitution matrix to be used for amino acid comparisons
default = blosum62 default = blosum62


Supported and Suggested Values for Gap Open and Extension in BLASTP, BLASTX, TBLASTN, and TBLASTX

Gaps Open Gap Extension
10 1
10 2
11 1
8 2
9 2

* Note: An enzyme was considered to be experimentally supported if it had a GO evidence code of IDA, IMP, IPI, IGI, or IEP in any of the data sources, or if it had a publication associated with it in BRENDA.